Crystal structure (native) of outer surface protein bba14 (orfd) from borrelia burgdorferi
PDB DOI: 10.2210/pdb7zjc/pdb
Classification: MEMBRANE PROTEIN Organism(s): Borreliella Burgdorferi B31
Deposited: 2022-04-10 Deposition Author(s): Brangulis, K.
Crystal structure (native) of outer surface protein bba14 (orfd) from borrelia burgdorferi
Primary Citation of Related Structures: 7ZJC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BBA14 (OrfD) | A | 100 | Borreliella Burgdorferi B31 | GAMGLPEEPSSPQESTLKALSLYEAHLSSYIMYLQTFLVKTKQKVNNKNYPEFTLFDTSKLKKDQTLKSIKTNIAALKNHIDKIKPIAMQIYKKYSKNIP |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-04-10 Deposition Author(s): Brangulis, K.