Crystal structure of the atp-gated p2x4 ion channel in the atp-bound, open state at 2.8 angstroms
PDB DOI: 10.2210/pdb4dw1/pdb
Classification: TRANSPORT PROTEIN Organism(s): Danio Rerio
Deposited: 2012-02-24 Deposition Author(s): Gouaux, E. , Hattori, M.
Crystal structure of the atp-gated p2x4 ion channel in the atp-bound, open state at 2.8 angstroms
Primary Citation of Related Structures: 4DW1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| P2X purinoceptor | A | 340 | Danio Rerio | GSSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTKTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAERFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQIMAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMK |
Method: X-RAY DIFFRACTION
Deposited Date: 2012-02-24 Deposition Author(s): Gouaux, E. , Hattori, M.