Bcl11a zf2-3 in complex with a dna sequence observed in the human globin locus containing motif tgtcca (c2221 crystal form)
PDB DOI: 10.2210/pdb9ylp/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2025-10-08 Deposition Author(s): Cheng, X. , Horton, J.R.
Method: X-RAY DIFFRACTION Resolution: 2.04 Å
Bcl11a zf2-3 in complex with a dna sequence observed in the human globin locus containing motif tgtcca (c2221 crystal form)
Primary Citation of Related Structures: 9YLP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BCL11 transcription factor A | A | 63 | Homo Sapiens , Synthetic Construct | HMPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLKRHMKTHMHKSSP |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-10-08 Deposition Author(s): Cheng, X. , Horton, J.R.