Complex structure of magi3 ww1 and iqsec3 ppxy motif
PDB DOI: 10.2210/pdb9w5c/pdb
Classification: PROTEIN BINDING Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2025-08-01 Deposition Author(s): Lin, L. , Wang, J. , Zhu, J.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | A | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | C | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | E | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | G | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | I | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 | K | 44 | Rattus Norvegicus , Synthetic Construct | RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK |
| IQ motif and SEC7 domain-containing protein 3 | B | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
| IQ motif and SEC7 domain-containing protein 3 | D | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
| IQ motif and SEC7 domain-containing protein 3 | F | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
| IQ motif and SEC7 domain-containing protein 3 | H | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
| IQ motif and SEC7 domain-containing protein 3 | J | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
| IQ motif and SEC7 domain-containing protein 3 | L | 18 | Rattus Norvegicus , Synthetic Construct | PPPPPPYNHPHQFCPPGS |
Method: X-RAY DIFFRACTION