PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

9W5C

Complex structure of magi3 ww1 and iqsec3 ppxy motif

PDB DOI: 10.2210/pdb9w5c/pdb

Classification: PROTEIN BINDING
Organism(s): Rattus Norvegicus , Synthetic Construct

Deposited: 2025-08-01
Deposition Author(s): Lin, L. , Wang, J. , Zhu, J.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.1 Å

Literature

Complex structure of magi3 ww1 and iqsec3 ppxy motif

Lin, L. , Wang, J. , Zhu, J.

Primary Citation of Related Structures: 9W5C


Proteins
Molecule Chains Sequence Length Organism Sequence
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 A 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 C 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 E 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 G 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 I 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 K 44 Rattus Norvegicus , Synthetic Construct RDENLEPLPKNWEMAYTDTGTIYFIDHNTKTTTWLDPRLCKKAK
IQ motif and SEC7 domain-containing protein 3 B 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
IQ motif and SEC7 domain-containing protein 3 D 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
IQ motif and SEC7 domain-containing protein 3 F 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
IQ motif and SEC7 domain-containing protein 3 H 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
IQ motif and SEC7 domain-containing protein 3 J 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
IQ motif and SEC7 domain-containing protein 3 L 18 Rattus Norvegicus , Synthetic Construct PPPPPPYNHPHQFCPPGS
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2025-08-01
Deposition Author(s): Lin, L. , Wang, J. , Zhu, J.