Crystal structure of bacillus subtilis degq tetramer
PDB DOI: 10.2210/pdb9vlh/pdb
Classification: TRANSCRIPTION Organism(s): Bacillus Subtilis
Deposited: 2025-06-25 Deposition Author(s): Fujimoto, Z. , Kimura, K. , Kishine, N.
Crystal structure of bacillus subtilis degq tetramer
Fujimoto, Z. , Kimura, K. , Kishine, N.
Primary Citation of Related Structures: 9VLH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Degradation enzyme regulation protein DegQ | A | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | B | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | C | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | D | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | E | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | F | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | G | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
| Degradation enzyme regulation protein DegQ | H | 46 | Bacillus Subtilis | MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-06-25 Deposition Author(s): Fujimoto, Z. , Kimura, K. , Kishine, N.