Crystal structure of the nkx2.1 homeodomain in complex with a 12-bp dna duplex containing a cacg motif variant
PDB DOI: 10.2210/pdb9u19/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2026-01-29 Deposition Author(s): Bommer, M. , Heinemann, U. , Malecka, M.Z.
Crystal structure of the nkx2.1 homeodomain in complex with a 12-bp dna duplex containing a cacg motif variant
Bommer, M. , Heinemann, U. , Malecka, M.Z.
Primary Citation of Related Structures: 9U19
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Homeobox protein Nkx-2.1 | C | 59 | Homo Sapiens , Synthetic Construct | RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQ |
| Homeobox protein Nkx-2.1 | F | 59 | Homo Sapiens , Synthetic Construct | RRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2026-01-29 Deposition Author(s): Bommer, M. , Heinemann, U. , Malecka, M.Z.