Structure of the pdz4 domain from human pdzk1 (nherf3) with the c-terminal residues (kstqf) of human urat1 transporter (slc22a12)
PDB DOI: 10.2210/pdb9rxp/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2025-07-11 Deposition Author(s): Hunte, C. , Mymrikov, E.V. , Wirth, C.
Structure of the pdz4 domain from human pdzk1 (nherf3) with the c-terminal residues (kstqf) of human urat1 transporter (slc22a12)
Hunte, C. , Mymrikov, E.V. , Wirth, C.
Primary Citation of Related Structures: 9RXP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3,Solute carrier family 22 member 12 | A | 90 | Homo Sapiens | GKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKKSTQF |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF3,Solute carrier family 22 member 12 | B | 90 | Homo Sapiens | GKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKKSTQF |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-07-11 Deposition Author(s): Hunte, C. , Mymrikov, E.V. , Wirth, C.