9Q8T
Nociceptive properties of u5-theraphotoxin-hs1b, a novel peptide from the cyriopagopus schmidti spider, active on nav1.7 channel
PDB DOI: 10.2210/pdb9q8t/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2025-02-25 Deposition Author(s): Landon, C. , Meudal, H.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nociceptive properties of u5-theraphotoxin-hs1b, a novel peptide from the cyriopagopus schmidti spider, active on nav1.7 channel
Primary Citation of Related Structures: 9Q8T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| U5-theraphotoxin-Hs1b 1 | A | 31 | N.A. | GCFGYKCDYYKGCCSGYVCSPTWKWCVRPGP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2025-02-25 Deposition Author(s): Landon, C. , Meudal, H.