Crystal structure of dihydrofolate reductase (dhfr) from the filarial nematode w. bancrofti in complex with nadph and methotrexate (mtx)
PDB DOI: 10.2210/pdb9oni/pdb
Classification: OXIDOREDUCTASE Organism(s): Wuchereria Bancrofti
Deposited: 2025-05-15 Deposition Author(s): Frey, K.M. , Goodey, N.M. , Kwarteng, S.
Crystal structure of dihydrofolate reductase (dhfr) from the filarial nematode w. bancrofti in complex with nadph and methotrexate (mtx)
Frey, K.M. , Goodey, N.M. , Kwarteng, S.
Primary Citation of Related Structures: 9ONI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| dihydrofolate reductase | A | 192 | Wuchereria Bancrofti | MAHHHHHHAMATRTLHMNLIVAVDGCGGIGRNGGMPWFLPAEMARFAKLTTLTTDSGKKNAVIMGRKVWESIPPKFRPLKSRFNVVLSKKMKEESNENVVVARSFESAVSLLQDMENIETIWNIGGREVYELGLNSPFLHQMYITRVEGDFLADVFFPRVDYGRFIKSTESEEMHEEKGIKYRYEIYTIKTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-05-15 Deposition Author(s): Frey, K.M. , Goodey, N.M. , Kwarteng, S.