Human pu.1 ets-domain (165-270) bound to d(5'-aataagcgiaagtggg-3') d(5'-tcccactttcgcttat-3') with an it mismatch
PDB DOI: 10.2210/pdb9ob0/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2025-04-21 Deposition Author(s): Poon, G.M.K. , Terrell, J.R.
Human pu.1 ets-domain (165-270) bound to d(5'-aataagcgiaagtggg-3') d(5'-tcccactttcgcttat-3') with an it mismatch
Primary Citation of Related Structures: 9OB0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor PU.1 | F | 106 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-04-21 Deposition Author(s): Poon, G.M.K. , Terrell, J.R.