X-ray diffraction structure of papain co-crystallized with leupeptin
PDB DOI: 10.2210/pdb9nat/pdb
Classification: HYDROLASE Organism(s): Carica Papaya , Synthetic Construct
Deposited: 2025-02-12 Deposition Author(s): Flowers, C.W. , Rodriguez, J.A. , Vlahakis, N.W.
X-ray diffraction structure of papain co-crystallized with leupeptin
Flowers, C.W. , Rodriguez, J.A. , Vlahakis, N.W.
Primary Citation of Related Structures: 9NAT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Papain | A | 212 | Carica Papaya , Synthetic Construct | IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
| leupeptin | C | 4 | Carica Papaya , Synthetic Construct | XLLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-02-12 Deposition Author(s): Flowers, C.W. , Rodriguez, J.A. , Vlahakis, N.W.