Backbone alpha-methylation in the villin headpiece miniprotein: hp35 with aib at position 15
PDB DOI: 10.2210/pdb9mf8/pdb
Classification: STRUCTURAL PROTEIN Organism(s): N.A.
Deposited: 2024-12-09 Deposition Author(s): Harmon, T.W. , Horne, W.S. , Lin, Y. , Osborne, S. , Sutton, R.T.
Backbone alpha-methylation in the villin headpiece miniprotein: hp35 with aib at position 15
Harmon, T.W. , Horne, W.S. , Lin, Y. , Osborne, S. , Sutton, R.T.
Primary Citation of Related Structures: 9MF8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Villin-1 | A | 36 | N.A. | LSDEDFKAVFGLTRAAFANLPLWKQQNLKKEKGLFX |
Method: SOLUTION NMR
Deposited Date: 2024-12-09 Deposition Author(s): Harmon, T.W. , Horne, W.S. , Lin, Y. , Osborne, S. , Sutton, R.T.