Crystal structure of the wrky dna-binding domain in complex with the w-box dna motif
PDB DOI: 10.2210/pdb9m0k/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Gossypium Hirsutum , Synthetic Construct
Deposited: 2025-02-25 Deposition Author(s): Liu, Y.L. , Shang, X.C. , Xiao, Q.
Crystal structure of the wrky dna-binding domain in complex with the w-box dna motif
Liu, Y.L. , Shang, X.C. , Xiao, Q.
Primary Citation of Related Structures: 9M0K
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| WRKY17 transcription factor | A | 66 | Gossypium Hirsutum , Synthetic Construct | MADIPHDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAVEDPRMLIVTYEGDHNHSHN |
| WRKY17 transcription factor | B | 66 | Gossypium Hirsutum , Synthetic Construct | MADIPHDDYSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERAVEDPRMLIVTYEGDHNHSHN |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-02-25 Deposition Author(s): Liu, Y.L. , Shang, X.C. , Xiao, Q.