PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

9KZG

Cryo-em structure of the lh1 complex from roseiflexus castenholzii

PDB DOI: 10.2210/pdb9kzg/pdb

Classification: STRUCTURAL PROTEIN
Organism(s): Roseiflexus Castenholzii

Deposited: 2024-12-10
Deposition Author(s): Wang, L. , Yu, L.-J.

Experimental Data Snapshot

Method: ELECTRON MICROSCOPY
Resolution: 2.28 Å

9kzg
Literature

Cryo-em structure of the lh1 complex from roseiflexus castenholzii

Wang, L. , Yu, L.-J.

Primary Citation of Related Structures: 9KZG


Proteins
Molecule Chains Sequence Length Organism Sequence
Alpha subunit of light-harvesting 1 B 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 C 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 D 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 E 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 F 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 G 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 H 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 I 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 J 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 K 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 L 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 M 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 N 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 O 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Alpha subunit of light-harvesting 1 A 42 Roseiflexus Castenholzii MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP
Experimental Data

Method: ELECTRON MICROSCOPY

Deposited Date: 2024-12-10
Deposition Author(s): Wang, L. , Yu, L.-J.