Cryo-em structure of the lh1 complex from roseiflexus castenholzii
PDB DOI: 10.2210/pdb9kzg/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Roseiflexus Castenholzii
Deposited: 2024-12-10 Deposition Author(s): Wang, L. , Yu, L.-J.
Method: ELECTRON MICROSCOPY Resolution: 2.28 Å
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha subunit of light-harvesting 1 | B | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | C | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | D | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | E | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | F | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | G | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | H | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | I | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | J | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | K | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | L | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | M | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | N | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | O | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
| Alpha subunit of light-harvesting 1 | A | 42 | Roseiflexus Castenholzii | MKDRPFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLRAP |
Method: ELECTRON MICROSCOPY