X-ray structure of the b1 domain of streptococcal protein g triple mutant t2q, n8d, and n37d (gb1-qdd).
PDB DOI: 10.2210/pdb9i2i/pdb
Classification: IMMUNE SYSTEM Organism(s): Streptococcus Sp.
Deposited: 2025-01-20 Deposition Author(s): Becker, L.M. , Engilberge, S. , Kapitonova, A. , Schanda, P.
X-ray structure of the b1 domain of streptococcal protein g triple mutant t2q, n8d, and n37d (gb1-qdd).
Becker, L.M. , Engilberge, S. , Kapitonova, A. , Schanda, P.
Primary Citation of Related Structures: 9I2I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 56 | Streptococcus Sp. | MQYKLILDGKTLKGETTTEAVDAATAEKVFKQYANDDGVDGEWTYDDATKTFTVTE |
| Immunoglobulin G-binding protein G | B | 56 | Streptococcus Sp. | MQYKLILDGKTLKGETTTEAVDAATAEKVFKQYANDDGVDGEWTYDDATKTFTVTE |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-01-20 Deposition Author(s): Becker, L.M. , Engilberge, S. , Kapitonova, A. , Schanda, P.