Rna binding domain of turnip crinkle virus p38, p38r
PDB DOI: 10.2210/pdb9gdw/pdb
Classification: RNA BINDING PROTEIN Organism(s): Turnip Crinkle Virus
Deposited: 2024-08-06 Deposition Author(s): Behrens, S.E. , Golbik, R. , Thondorf, I. , Weininger, U.
Rna binding domain of turnip crinkle virus p38, p38r
Behrens, S.E. , Golbik, R. , Thondorf, I. , Weininger, U.
Primary Citation of Related Structures: 9GDW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Capsid protein | A | 45 | Turnip Crinkle Virus | MENDPRVRKFASDGAQWAIKWQKKGWSTLTSRQKQTARAAMGIKL |
Method: SOLUTION NMR
Deposited Date: 2024-08-06 Deposition Author(s): Behrens, S.E. , Golbik, R. , Thondorf, I. , Weininger, U.