Crystal structure of human chymase in complex with compound1
PDB DOI: 10.2210/pdb9gbh/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2024-07-31 Deposition Author(s): Ackerstaff, J. , Albrecht-Kuepper, B. , Boerngen, K. , Dorleans-Juste, P. , Fuerstner, C. , Geiss, V. , Hartmann, E. , Heitmeier, S. , Joerissen, H. , Lapointe, C. , Meier, H. , Mittendorf, J. , Schaefer, M. , Schamberger, J. , Straub, A. , Tersteegen, A. , Tinel, H. , Vincent, L. , Zimmermann, K. , Zubow, D.
Method: X-RAY DIFFRACTION Resolution: 2.375 Å
Crystal structure of human chymase in complex with compound1
Ackerstaff, J. , Albrecht-Kuepper, B. , Boerngen, K. , Dorleans-Juste, P. , Fuerstner, C. , Geiss, V. , Hartmann, E. , Heitmeier, S. , Joerissen, H. , Lapointe, C. , Meier, H. , Mittendorf, J. , Schaefer, M. , Schamberger, J. , Straub, A. , Tersteegen, A. , Tinel, H. , Vincent, L. , Zimmermann, K. , Zubow, D.
Primary Citation of Related Structures: 9GBH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chymase | AAA | 226 | Homo Sapiens | IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQRNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGAAQGIVSYGRSDAKPPAVFTRISHYQPWINQILQAN |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-31 Deposition Author(s): Ackerstaff, J. , Albrecht-Kuepper, B. , Boerngen, K. , Dorleans-Juste, P. , Fuerstner, C. , Geiss, V. , Hartmann, E. , Heitmeier, S. , Joerissen, H. , Lapointe, C. , Meier, H. , Mittendorf, J. , Schaefer, M. , Schamberger, J. , Straub, A. , Tersteegen, A. , Tinel, H. , Vincent, L. , Zimmermann, K. , Zubow, D.