The hiv protease inhibitor amprenavir binding to the active site of cryphonectria parasitica endothiapepsin
PDB DOI: 10.2210/pdb9fvo/pdb
Classification: HYDROLASE Organism(s): Cryphonectria Parasitica
Deposited: 2024-06-27 Deposition Author(s): Falke, S. , Guenther, S. , Meents, A. , Senst, J.M.
The hiv protease inhibitor amprenavir binding to the active site of cryphonectria parasitica endothiapepsin
Falke, S. , Guenther, S. , Meents, A. , Senst, J.M.
Primary Citation of Related Structures: 9FVO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endothiapepsin | A | 330 | Cryphonectria Parasitica | STGSATTTPIDSLDDAYITPVQIGTPAQTLNLDFDTGSSDLWVFSSETTASEVDGQTIYTPSKSTTAKLLSGATWSISYGDGSSSSGDVYTDTVSVGGLTVTGQAVESAKKVSSSFTEDSTIDGLLGLAFSTLNTVSPTQQKTFFDNAKASLDSPVFTADLGYHAPGTYNFGFIDTTAYTGSITYTAVSTKQGFWEWTSTGYAVGSGTFKSTSIDGIADTGTTLLYLPATVVSAYWAQVSGAKSSSSVGGYVFPCSATLPSFTFGVGSARIVIPGDYIDFGPISTGSSSCFGGIQSSAGIGINIFGDVALKAAFVVFNGATTPTLGFASK |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-27 Deposition Author(s): Falke, S. , Guenther, S. , Meents, A. , Senst, J.M.