Crystal structure of thiol peroxidase mutant (c94a) in complex with metro-p3* (h. pylori)
PDB DOI: 10.2210/pdb9f65/pdb
Classification: OXIDOREDUCTASE Organism(s): Helicobacter Pylori
Deposited: 2024-04-30 Deposition Author(s): Fiedler, M.K. , Friedrich, V. , Fuchs, S. , Gerhard, M. , Gong, R. , Groll, M. , Hess, C. , Huber, M. , Mejias-Luque, R. , Mibus, C. , Pfeiffer, D. , Reinhardt, T. , Rox, K. , Sieber, S.A.
Crystal structure of thiol peroxidase mutant (c94a) in complex with metro-p3* (h. pylori)
Fiedler, M.K. , Friedrich, V. , Fuchs, S. , Gerhard, M. , Gong, R. , Groll, M. , Hess, C. , Huber, M. , Mejias-Luque, R. , Mibus, C. , Pfeiffer, D. , Reinhardt, T. , Rox, K. , Sieber, S.A.
Primary Citation of Related Structures: 9F65
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thiol peroxidase | A | 188 | Helicobacter Pylori | MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK |
| Thiol peroxidase | B | 188 | Helicobacter Pylori | MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-30 Deposition Author(s): Fiedler, M.K. , Friedrich, V. , Fuchs, S. , Gerhard, M. , Gong, R. , Groll, M. , Hess, C. , Huber, M. , Mejias-Luque, R. , Mibus, C. , Pfeiffer, D. , Reinhardt, T. , Rox, K. , Sieber, S.A.