Non-canonical structure of the human cortactin sh3 domain in complex with wip-derived peptide
PDB DOI: 10.2210/pdb9ezp/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2024-04-13 Deposition Author(s): Chill, J.H. , Sokolik, C.G.
Method: SOLUTION NMR Resolution: N.A.
Non-canonical structure of the human cortactin sh3 domain in complex with wip-derived peptide
Primary Citation of Related Structures: 9EZP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cDNA FLJ34459 fis, clone HLUNG2002916, highly similar to SRC SUBSTRATE CORTACTIN | A | 57 | Homo Sapiens , Synthetic Construct | GITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ |
| WAS/WASL-interacting protein family member 1 | B | 19 | Homo Sapiens , Synthetic Construct | QRNRMPPPRPDVGSKPDSI |
Method: SOLUTION NMR
Deposited Date: 2024-04-13 Deposition Author(s): Chill, J.H. , Sokolik, C.G.