Crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella philomiragia (monoclinic p form)
PDB DOI: 10.2210/pdb9cwl/pdb
Classification: LIPID TRANSPORT Organism(s): Francisella Philomiragia
Deposited: 2024-07-29 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella philomiragia (monoclinic p form)
Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 9CWL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Outer membrane lipocarrier LolA family protein | A | 197 | Francisella Philomiragia | MASGSSHHHHHHSSGENLYFQGHLDLSKDSDFQAVEKQLTKDTNISGKFIQIRQIAGLNSSLKSSGTFKLTNDGSLLWQQQSPIKTTMQMSKNKLTQTIMDNPPTVLTRDDQPIVFTFTSVFMSVFKGDTKTISEFFNINFDGNTQNWTITLTPKSSPLNKAIKEIILKGNRYITNIDVADTQDNIIKIELFDITTN |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-29 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease (Ssgcid)