X-ray diffraction structure of papain co-crystallized with e-64
PDB DOI: 10.2210/pdb9ckt/pdb
Classification: HYDROLASE Organism(s): Carica Papaya
Deposited: 2024-07-09 Deposition Author(s): Rodriguez, J.A. , Vlahakis, N.W.
X-ray diffraction structure of papain co-crystallized with e-64
Rodriguez, J.A. , Vlahakis, N.W.
Primary Citation of Related Structures: 9CKT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Papain | A | 212 | Carica Papaya | IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-09 Deposition Author(s): Rodriguez, J.A. , Vlahakis, N.W.