Crystal structure of staphylococcal nuclease variant delta+phs v23e/l36r at cryogenic temperature
PDB DOI: 10.2210/pdb9cij/pdb
Classification: HYDROLASE Organism(s): Staphylococcus Aureus
Deposited: 2024-07-03 Deposition Author(s): Garcia-Moreno E., B. , Schlessman, L.J. , Siegler, M.A. , Zhang, Y.
Crystal structure of staphylococcal nuclease variant delta+phs v23e/l36r at cryogenic temperature
Garcia-Moreno E., B. , Schlessman, L.J. , Siegler, M.A. , Zhang, Y.
Primary Citation of Related Structures: 9CIJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Thermonuclease | A | 143 | Staphylococcus Aureus | ATSTKKLHKEPATLIKAIDGDTEKLMYKGQPMTFRRLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSEDNADSGQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-03 Deposition Author(s): Garcia-Moreno E., B. , Schlessman, L.J. , Siegler, M.A. , Zhang, Y.