Solution nmr structure of the fungal loosenin pcalool12 from phanerochaete carnosa
PDB DOI: 10.2210/pdb9ce9/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Phanerochaete Carnosa (Strain Hhb-10118-Sp)
Deposited: 2024-06-26 Deposition Author(s): Buchko, G.W. , Master, E.R.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the fungal loosenin pcalool12 from phanerochaete carnosa
Primary Citation of Related Structures: 9CE9
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RlpA-like protein double-psi beta-barrel domain-containing protein | A | 105 | Phanerochaete Carnosa (Strain Hhb-10118-Sp) | GHAPAEKRSTTREGRGTWYDTGLGACGWNNVNSDTVIALSPSVYSGGSHCGQTVTVTNVVTGAKATGTVADECPGCGPNDIDMTPGLFQQLGSLDEGVLTVSWTL |
Method: SOLUTION NMR
Deposited Date: 2024-06-26 Deposition Author(s): Buchko, G.W. , Master, E.R.