Crystal structure of mdm2-peptide complex
PDB DOI: 10.2210/pdb9cdz/pdb
Classification: ONCOPROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-06-25 Deposition Author(s): Bera, A.K. , Bhardwaj, G. , Rettie, S.
Crystal structure of mdm2-peptide complex
Bera, A.K. , Bhardwaj, G. , Rettie, S.
Primary Citation of Related Structures: 9CDZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Mdm2 | A | 108 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN |
E3 ubiquitin-protein ligase Mdm2 | C | 108 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDAAQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN |
Peptide | B | 16 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GLIDGTEGTDFESMWR |
Peptide | D | 16 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GLIDGTEGTDFESMWR |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-25 Deposition Author(s): Bera, A.K. , Bhardwaj, G. , Rettie, S.