Structure of shrt_binder
PDB DOI: 10.2210/pdb9bk7/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2024-04-26 Deposition Author(s): Baker, D. , Bera, A.K. , Kang, A. , Torres, S.V.
Structure of shrt_binder
Baker, D. , Bera, A.K. , Kang, A. , Torres, S.V.
Primary Citation of Related Structures: 9BK7
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SHRT_binder | A | 121 | Synthetic Construct | MSGGPKTVVVRLSPSMNEEQAAEIGREAGKAALAAGDRLVFVGPADQSYAAMKAAMEAGLPEVTMYALDFSDAESALKAAEVAEDEGDEEVAEVAREIAEEIKAGGSGSHHWGSTHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-26 Deposition Author(s): Baker, D. , Bera, A.K. , Kang, A. , Torres, S.V.