Crystal structure of ubc13 with a new active site loop conformation
PDB DOI: 10.2210/pdb9biv/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2024-04-24 Deposition Author(s): Edwards, R.A. , Farraj, R.A. , Glover, J.N.M.
Crystal structure of ubc13 with a new active site loop conformation
Edwards, R.A. , Farraj, R.A. , Glover, J.N.M.
Primary Citation of Related Structures: 9BIV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin-conjugating enzyme E2 variant 2 | A | 145 | Homo Sapiens | MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
| Ubiquitin-conjugating enzyme E2 N | B | 152 | Homo Sapiens | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-24 Deposition Author(s): Edwards, R.A. , Farraj, R.A. , Glover, J.N.M.