Nmr solution structure of paws derived peptide-25 (pdp-25)
PDB DOI: 10.2210/pdb9bf4/pdb
Classification: PLANT PROTEIN Organism(s): N.A.
Deposited: 2024-04-16 Deposition Author(s): Clark, R.J. , Fisher, M.F. , Hajiaghaalipour, F. , Mylne, J.S. , Payne, C.D. , Rosengren, K.J. , Wong, W.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of paws derived peptide-25 (pdp-25)
Clark, R.J. , Fisher, M.F. , Hajiaghaalipour, F. , Mylne, J.S. , Payne, C.D. , Rosengren, K.J. , Wong, W.
Primary Citation of Related Structures: 9BF4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Paws Derived Peptide-25 | A | 31 | N.A. | GFCWGDLCVPYGTCSQLPPWLQDMCAAASFD |
Method: SOLUTION NMR
Deposited Date: 2024-04-16 Deposition Author(s): Clark, R.J. , Fisher, M.F. , Hajiaghaalipour, F. , Mylne, J.S. , Payne, C.D. , Rosengren, K.J. , Wong, W.