Solution nmr structure of the human letm1 f-ef-hand domain in the presence of calcium
PDB DOI: 10.2210/pdb9ba1/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2024-04-03 Deposition Author(s): Lin, Q.T. , Stathopulos, P.B.
Solution nmr structure of the human letm1 f-ef-hand domain in the presence of calcium
Primary Citation of Related Structures: 9BA1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mitochondrial proton/calcium exchanger protein | A | 63 | Homo Sapiens | GSHMASTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKED |
Method: SOLUTION NMR
Deposited Date: 2024-04-03 Deposition Author(s): Lin, Q.T. , Stathopulos, P.B.