Wheat germ agglutinin (wga) domain a
PDB DOI: 10.2210/pdb8vu6/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Triticum Aestivum
Deposited: 2024-01-29 Deposition Author(s): Del Rio-Portilla, F. , Garcia-Hernandez, E. , Titaux-Delgado, G.A.
Wheat germ agglutinin (wga) domain a
Del Rio-Portilla, F. , Garcia-Hernandez, E. , Titaux-Delgado, G.A.
Primary Citation of Related Structures: 8VU6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Agglutinin isolectin 1 | A | 46 | Triticum Aestivum | AAAAQRCGEQGSNMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWT |
Method: SOLUTION NMR
Deposited Date: 2024-01-29 Deposition Author(s): Del Rio-Portilla, F. , Garcia-Hernandez, E. , Titaux-Delgado, G.A.