Crystal structure of superbinder src sh2 domain with cysteine to serine mutations
PDB DOI: 10.2210/pdb8vcf/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2023-12-14 Deposition Author(s): Hashem, A. , Krogsgaard, M. , Nyovanie, S. , Oltean, N. , Patskovsky, Y.
Crystal structure of superbinder src sh2 domain with cysteine to serine mutations
Hashem, A. , Krogsgaard, M. , Nyovanie, S. , Oltean, N. , Patskovsky, Y.
Primary Citation of Related Structures: 8VCF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 3 of Proto-oncogene tyrosine-protein kinase Src | A | 127 | Homo Sapiens | MGSSHHHHHHGLVPRGSHMDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETVKGAYALSVSDFDNAKGLNVKHYLIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLSHRLTTVSPTS |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-12-14 Deposition Author(s): Hashem, A. , Krogsgaard, M. , Nyovanie, S. , Oltean, N. , Patskovsky, Y.