PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8V5V

Structure of a sars-cov-2 spike s2 subunit in a pre-fusion, open conformation

PDB DOI: 10.2210/pdb8v5v/pdb

Classification: VIRAL PROTEIN
Organism(s): Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4

Deposited: 2023-12-01
Deposition Author(s): Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.

Experimental Data Snapshot

Method: ELECTRON MICROSCOPY
Resolution: 2.93 Å

8v5v
Literature

Structure of a sars-cov-2 spike s2 subunit in a pre-fusion, open conformation

Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.

Primary Citation of Related Structures: 8V5V


Proteins
Molecule Chains Sequence Length Organism Sequence
Variable domain of the light chain from the human antibody 6C10 G 108 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI
Variable domain of the light chain from the human antibody 6C10 E 108 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI
Variable domain of the heavy chain from the human antibody 6C10 F 125 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV
Variable domain of the light chain from the human antibody 6C10 D 108 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI
Variable domain of the heavy chain from the human antibody 6C10 C 125 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV
Variable domain of the heavy chain from the human antibody 6C10 B 125 Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV
Experimental Data

Method: ELECTRON MICROSCOPY

Deposited Date: 2023-12-01
Deposition Author(s): Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.