Structure of a sars-cov-2 spike s2 subunit in a pre-fusion, open conformation
PDB DOI: 10.2210/pdb8v5v/pdb
Classification: VIRAL PROTEIN Organism(s): Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4
Deposited: 2023-12-01 Deposition Author(s): Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.
Method: ELECTRON MICROSCOPY Resolution: 2.93 Å
Structure of a sars-cov-2 spike s2 subunit in a pre-fusion, open conformation
Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.
Primary Citation of Related Structures: 8V5V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Variable domain of the light chain from the human antibody 6C10 | G | 108 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI |
| Variable domain of the light chain from the human antibody 6C10 | E | 108 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI |
| Variable domain of the heavy chain from the human antibody 6C10 | F | 125 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV |
| Variable domain of the light chain from the human antibody 6C10 | D | 108 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | AIRMTQSPSTLSVSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLVYGASTRATGIPARFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPPFTFGPGTKVDI |
| Variable domain of the heavy chain from the human antibody 6C10 | C | 125 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV |
| Variable domain of the heavy chain from the human antibody 6C10 | B | 125 | Homo Sapiens , Severe Acute Respiratory Syndrome Coronavirus 2 , Tequatrovirus T4 | QVQLVQSGAEVRKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGWVIMTRDTSISTAYMELSRLTSDDTAVYYCARCGARSYYYDSGDYCAFDIWGQGTVVTV |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-12-01 Deposition Author(s): Diaz, R. , Hastie, K. , Ollmann-Saphire, E. , Olmedillas, E.