Crystal structure of ciad from campylobacter jejuni (c-terminal fragment, orthorhombic p form)
PDB DOI: 10.2210/pdb8uz8/pdb
Classification: OXIDOREDUCTASE Organism(s): Campylobacter Jejuni
Deposited: 2023-11-14 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Crystal structure of ciad from campylobacter jejuni (c-terminal fragment, orthorhombic p form)
Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)
Primary Citation of Related Structures: 8UZ8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 2-oxoglutarate:acceptor oxidoreductase | A | 195 | Campylobacter Jejuni | MHHHHHHSSGVDLWSHPQFEKGTENLYFQSNIMNLEDLAKKTISEVSSIMEEQRRQNEILKEQELNRKTEIKDELPPMEFVCEELDTPQDLEDKISMAKFEEEQKIQNNIEISTQENKEFKKEEPFLQNEILNPSVMTEVQTLNEDIFLKHLRERILVLFEGLNSIKKDDLENRLNLTINFLEFLLANIEDKLKK |
| 2-oxoglutarate:acceptor oxidoreductase | B | 195 | Campylobacter Jejuni | MHHHHHHSSGVDLWSHPQFEKGTENLYFQSNIMNLEDLAKKTISEVSSIMEEQRRQNEILKEQELNRKTEIKDELPPMEFVCEELDTPQDLEDKISMAKFEEEQKIQNNIEISTQENKEFKKEEPFLQNEILNPSVMTEVQTLNEDIFLKHLRERILVLFEGLNSIKKDDLENRLNLTINFLEFLLANIEDKLKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-11-14 Deposition Author(s): Seattle Structural Genomics Center For Infectious Disease , Seattle Structural Genomics Center For Infectious Disease (Ssgcid)