Crystal structure of taf14 in complex with yng1
PDB DOI: 10.2210/pdb8u77/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae , Synthetic Construct
Deposited: 2023-09-14 Deposition Author(s): Kutateladze, T.G. , Nguyen, M.C. , Wei, P.C. , Zhang, G.Y.
Crystal structure of taf14 in complex with yng1
Kutateladze, T.G. , Nguyen, M.C. , Wei, P.C. , Zhang, G.Y.
Primary Citation of Related Structures: 8U77
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 14 | A | 72 | Saccharomyces Cerevisiae , Synthetic Construct | SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| Transcription initiation factor TFIID subunit 14 | C | 72 | Saccharomyces Cerevisiae , Synthetic Construct | SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| Transcription initiation factor TFIID subunit 14 | E | 72 | Saccharomyces Cerevisiae , Synthetic Construct | SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| Transcription initiation factor TFIID subunit 14 | G | 72 | Saccharomyces Cerevisiae , Synthetic Construct | SVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLYSLPEGLLKSLWDYVKKNT |
| Protein YNG1 | B | 12 | Saccharomyces Cerevisiae , Synthetic Construct | EPKLLLKINLKK |
| Protein YNG1 | D | 12 | Saccharomyces Cerevisiae , Synthetic Construct | EPKLLLKINLKK |
| Protein YNG1 | F | 12 | Saccharomyces Cerevisiae , Synthetic Construct | EPKLLLKINLKK |
| Protein YNG1 | H | 12 | Saccharomyces Cerevisiae , Synthetic Construct | EPKLLLKINLKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-09-14 Deposition Author(s): Kutateladze, T.G. , Nguyen, M.C. , Wei, P.C. , Zhang, G.Y.