Diphosphoinositol polyphosphate phosphohydrolase 1 (dipp1/nudt3) in complex with scyllo-l-1,4-[pp]2-(2,3)ip2, mg, and fluoride ion
PDB DOI: 10.2210/pdb8t99/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2023-06-23 Deposition Author(s): Shears, S.B. , Wang, H. , Zong, G.
Diphosphoinositol polyphosphate phosphohydrolase 1 (dipp1/nudt3) in complex with scyllo-l-1,4-[pp]2-(2,3)ip2, mg, and fluoride ion
Shears, S.B. , Wang, H. , Zong, G.
Primary Citation of Related Structures: 8T99
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Diphosphoinositol polyphosphate phosphohydrolase 1 | A | 148 | Homo Sapiens | MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYS |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-06-23 Deposition Author(s): Shears, S.B. , Wang, H. , Zong, G.