Structural insights into cellular control of the human cpeb3 prion, functionally regulated by a labile-amyloid-forming segment
PDB DOI: 10.2210/pdb8spa/pdb
Classification: PROTEIN FIBRIL Organism(s): Homo Sapiens
Deposited: 2023-05-02 Deposition Author(s): Boyer, D.R. , Fioriti, L. , Flores, M.D. , Rodriguez, J.A. , Sawaya, M.R. , Zink, S.
Structural insights into cellular control of the human cpeb3 prion, functionally regulated by a labile-amyloid-forming segment
Boyer, D.R. , Fioriti, L. , Flores, M.D. , Rodriguez, J.A. , Sawaya, M.R. , Zink, S.
Primary Citation of Related Structures: 8SPA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cytoplasmic polyadenylation element-binding protein 3 | A | 49 | Homo Sapiens | LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF |
Cytoplasmic polyadenylation element-binding protein 3 | B | 49 | Homo Sapiens | LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF |
Cytoplasmic polyadenylation element-binding protein 3 | C | 49 | Homo Sapiens | LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF |
Cytoplasmic polyadenylation element-binding protein 3 | D | 49 | Homo Sapiens | LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF |
Cytoplasmic polyadenylation element-binding protein 3 | E | 49 | Homo Sapiens | LSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTF |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-05-02 Deposition Author(s): Boyer, D.R. , Fioriti, L. , Flores, M.D. , Rodriguez, J.A. , Sawaya, M.R. , Zink, S.