Crystal structure of cbx7 with compound unc4976
PDB DOI: 10.2210/pdb8sii/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2023-04-16 Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)
Crystal structure of cbx7 with compound unc4976
Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 8SII
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 56 | Homo Sapiens , Synthetic Construct | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| Chromobox protein homolog 7 | B | 56 | Homo Sapiens , Synthetic Construct | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| UNC4976 | F | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
| UNC4976 | G | 6 | Homo Sapiens , Synthetic Construct | XFALXX |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-04-16 Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)