PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

8SII

Crystal structure of cbx7 with compound unc4976

PDB DOI: 10.2210/pdb8sii/pdb

Classification: TRANSCRIPTION
Organism(s): Homo Sapiens , Synthetic Construct

Deposited: 2023-04-16
Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.37 Å

Literature

Crystal structure of cbx7 with compound unc4976

Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)

Primary Citation of Related Structures: 8SII


Proteins
Molecule Chains Sequence Length Organism Sequence
Chromobox protein homolog 7 A 56 Homo Sapiens , Synthetic Construct GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
Chromobox protein homolog 7 B 56 Homo Sapiens , Synthetic Construct GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE
UNC4976 F 6 Homo Sapiens , Synthetic Construct XFALXX
UNC4976 G 6 Homo Sapiens , Synthetic Construct XFALXX
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2023-04-16
Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Huang, R. , Min, J. , Song, X. , Structural Genomics Consortium (Sgc)