8SG2
Bivalent interactions of pin1 with the c-terminal tail of pkc
PDB DOI: 10.2210/pdb8sg2/pdb
Classification: ISOMERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2023-04-11 Deposition Author(s): Chen, X.R. , Dixit, K. , Igumenova, T.I. , Yang, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Bivalent interactions of pin1 with the c-terminal tail of pkc
Chen, X.R. , Dixit, K. , Igumenova, T.I. , Yang, Y.
Primary Citation of Related Structures: 8SG2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 163 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
| Protein kinase C beta type | B | 25 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XVLTPPDQEVIRNIDQSEFEGFSFX |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2023-04-11 Deposition Author(s): Chen, X.R. , Dixit, K. , Igumenova, T.I. , Yang, Y.