P301s tau filaments from the brains of tg2541 transgenic mouse line
PDB DOI: 10.2210/pdb8q96/pdb
Classification: PROTEIN FIBRIL Organism(s): Mus Musculus
Deposited: 2023-08-19 Deposition Author(s): Crowther, R.A. , Goedert, M. , Lavenir, I. , Macdonald, J. , Murzin, A.G. , Scheres, S.H.W. , Schweighauser, M.
P301s tau filaments from the brains of tg2541 transgenic mouse line
Crowther, R.A. , Goedert, M. , Lavenir, I. , Macdonald, J. , Murzin, A.G. , Scheres, S.H.W. , Schweighauser, M.
Primary Citation of Related Structures: 8Q96
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform Tau-E of Microtubule-associated protein tau | A | 56 | Mus Musculus | KVQIINKKLDLSNVQSKCGSKDNIKHVSGGGSVQIVYKPVDLSKVTSKCGSLGNIH |
| Isoform Tau-E of Microtubule-associated protein tau | D | 56 | Mus Musculus | KVQIINKKLDLSNVQSKCGSKDNIKHVSGGGSVQIVYKPVDLSKVTSKCGSLGNIH |
| Isoform Tau-E of Microtubule-associated protein tau | G | 56 | Mus Musculus | KVQIINKKLDLSNVQSKCGSKDNIKHVSGGGSVQIVYKPVDLSKVTSKCGSLGNIH |
| Isoform Tau-E of Microtubule-associated protein tau | J | 56 | Mus Musculus | KVQIINKKLDLSNVQSKCGSKDNIKHVSGGGSVQIVYKPVDLSKVTSKCGSLGNIH |
| Unknown protein | B | 12 | Mus Musculus | XXXXXXXXXXXX |
| Unknown protein | E | 12 | Mus Musculus | XXXXXXXXXXXX |
| Unknown protein | H | 12 | Mus Musculus | XXXXXXXXXXXX |
| Unknown protein | K | 12 | Mus Musculus | XXXXXXXXXXXX |
| Unknown protein | C | 10 | Mus Musculus | XXXXXXXXXX |
| Unknown protein | F | 10 | Mus Musculus | XXXXXXXXXX |
| Unknown protein | I | 10 | Mus Musculus | XXXXXXXXXX |
| Unknown protein | L | 10 | Mus Musculus | XXXXXXXXXX |
Method: ELECTRON MICROSCOPY
Deposited Date: 2023-08-19 Deposition Author(s): Crowther, R.A. , Goedert, M. , Lavenir, I. , Macdonald, J. , Murzin, A.G. , Scheres, S.H.W. , Schweighauser, M.