Characterization of the zinc finger u-protein hvo_0758 from haloferax volcanii: biological roles, zinc binding, and nmr solution structure
PDB DOI: 10.2210/pdb8q5b/pdb
Classification: METAL BINDING PROTEIN Organism(s): Haloferax Volcanii Ds2
Deposited: 2023-08-08 Deposition Author(s): Pyper, D.J. , Schwalbe, H.
Characterization of the zinc finger u-protein hvo_0758 from haloferax volcanii: biological roles, zinc binding, and nmr solution structure
Primary Citation of Related Structures: 8Q5B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Small CPxCG-related zinc finger protein | A | 56 | Haloferax Volcanii Ds2 | MKTTRKGLRDGELEKDTYGRLTCSECGESLKKKNDPDEVFSVRICADCGREWKELR |
Method: SOLUTION NMR
Deposited Date: 2023-08-08 Deposition Author(s): Pyper, D.J. , Schwalbe, H.