8POI
Molecular docking of spf30 tudor domain with synthetic inhibitor 4-(pyridin-2-yl)thiazol-2-amine
PDB DOI: 10.2210/pdb8poi/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2023-07-04 Deposition Author(s): Borggraefe, J. , Gaussmann, S. , Sattler, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Molecular docking of spf30 tudor domain with synthetic inhibitor 4-(pyridin-2-yl)thiazol-2-amine
Borggraefe, J. , Gaussmann, S. , Sattler, M.
Primary Citation of Related Structures: 8POI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Survival of motor neuron-related-splicing factor 30 | A | 64 | Homo Sapiens | ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2023-07-04 Deposition Author(s): Borggraefe, J. , Gaussmann, S. , Sattler, M.