Solution nmr structure of notch1 tmd
PDB DOI: 10.2210/pdb8or5/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2023-04-13 Deposition Author(s): Guschtschin-Schmidt, N. , Muhle-Goll, C.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of notch1 tmd
Guschtschin-Schmidt, N. , Muhle-Goll, C.
Primary Citation of Related Structures: 8OR5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Notch 1 extracellular truncation | A | 30 | N.A. | KKKLHFMYVAAAAFVLLFFVGCGVLLSKKK |
Method: SOLUTION NMR
Deposited Date: 2023-04-13 Deposition Author(s): Guschtschin-Schmidt, N. , Muhle-Goll, C.