Crystal structure of nfil3 in complex with ttacgtaa dna
PDB DOI: 10.2210/pdb8k8a/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2023-07-29 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.
Crystal structure of nfil3 in complex with ttacgtaa dna
Chen, S.Z. , Liu, K. , Min, J.R.
Primary Citation of Related Structures: 8K8A
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nuclear factor interleukin-3-regulated protein | A | 73 | Homo Sapiens , Synthetic Construct | GEFMPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQ |
Nuclear factor interleukin-3-regulated protein | B | 73 | Homo Sapiens , Synthetic Construct | GEFMPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLSLKLKFGLISSTAYAQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2023-07-29 Deposition Author(s): Chen, S.Z. , Liu, K. , Min, J.R.