Antibacterial peptide, mehamycin
PDB DOI: 10.2210/pdb8gxt/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Meloidogyne Hapla
Deposited: 2022-09-21 Deposition Author(s): Isozumi, N. , Ohki, S.
Antibacterial peptide, mehamycin
Primary Citation of Related Structures: 8GXT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Antibacterial peptide | A | 61 | Meloidogyne Hapla | DVLSGKYKGPCYFGIIPCFVRGCKPKLFDAHRKLCIKLCKQEGFKSGHCSNFFKFQCWCTR |
Method: SOLUTION NMR
Deposited Date: 2022-09-21 Deposition Author(s): Isozumi, N. , Ohki, S.