X-ray crystal structure of methylorubrum extorquens am1 lanmodulin (lanm) with neodymium (iii) bound at ph 7
PDB DOI: 10.2210/pdb8fns/pdb
Classification: METAL BINDING PROTEIN Organism(s): Alicyclobacillus Acidoterrestris (Strain Atcc 49025 / Dsm 3922 / Cip 106132 / Ncimb 13137 / Gd3B)
Deposited: 2022-12-28 Deposition Author(s): Boal, A.K. , Jung, J.J. , Lin, C.-Y.
X-ray crystal structure of methylorubrum extorquens am1 lanmodulin (lanm) with neodymium (iii) bound at ph 7
Boal, A.K. , Jung, J.J. , Lin, C.-Y.
Primary Citation of Related Structures: 8FNS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
EF-hand domain-containing protein | A | 105 | Alicyclobacillus Acidoterrestris (Strain Atcc 49025 / Dsm 3922 / Cip 106132 / Ncimb 13137 / Gd3B) | VDIAAFDPDKDGTIDLKEALAAGSAAFDKLDPDKDGTLDAKELKGRVSEADLKKLDPDNDGTLDKKEYLAAVEAQFKAANPDNDGTIDARELASPAGSALVNLIR |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-12-28 Deposition Author(s): Boal, A.K. , Jung, J.J. , Lin, C.-Y.