Crystal structure of ack1 kinase k161q mutant in complex with the selective inhibitor (r)-9b
PDB DOI: 10.2210/pdb8fe9/pdb
Classification: TRANSFERASE/TRANSFERASE INHIBITOR Organism(s): Homo Sapiens
Deposited: 2022-12-06 Deposition Author(s): Kan, Y. , Miller, W.T. , Paung, Y. , Seeliger, M.S.
Method: X-RAY DIFFRACTION Resolution: 3.2 Å
Crystal structure of ack1 kinase k161q mutant in complex with the selective inhibitor (r)-9b
Kan, Y. , Miller, W.T. , Paung, Y. , Seeliger, M.S.
Primary Citation of Related Structures: 8FE9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Activated CDC42 kinase 1 | A | 287 | Homo Sapiens | GAMGSGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLQPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-12-06 Deposition Author(s): Kan, Y. , Miller, W.T. , Paung, Y. , Seeliger, M.S.